PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P18140_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 374aa    MW: 41768 Da    PI: 5.1602
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P18140_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.42.6e-4861561128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.........................kvkaeekewyfFsk 63 
                            lppGfrF+Ptd+elv +yLk+kv+g ++el e+i+ +++yk++PwdLp                           ++ +  ew+fF++
  GSMUA_Achr5P18140_001   6 LPPGFRFRPTDDELVGYYLKRKVAGLSIEL-EIIPVIELYKYDPWDLPDyyqhflvlsapiklvcevsdrsvtlYFSIGYLEWFFFCP 92 
                            79****************************.99**************955899********99998888777654444777******* PP

                    NAM  64 rdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            rd+ky++g+r+nrat sgyWkatgkd+++ + + ++ g++ktLvfy+grap ge+t Wvmheyrl
  GSMUA_Achr5P18140_001  93 RDRKYPNGTRTNRATGSGYWKATGKDRKIAC-EPSVYGVRKTLVFYRGRAPGGERTGWVMHEYRL 156
                            *******************************.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-533179IPR003441NAC domain
PROSITE profilePS5100552.6716179IPR003441NAC domain
PfamPF023651.2E-287156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSSVSLPPGF RFRPTDDELV GYYLKRKVAG LSIELEIIPV IELYKYDPWD LPDYYQHFLV  60
LSAPIKLVCE VSDRSVTLYF SIGYLEWFFF CPRDRKYPNG TRTNRATGSG YWKATGKDRK  120
IACEPSVYGV RKTLVFYRGR APGGERTGWV MHEYRLCEDL YQGSTNFLGA FALCRVVKKN  180
DHGLKAGDPH AESKAKRCSS SAAESGYRGY IDNVLSISEE NSTVVTNVSE KNEDSTPITS  240
PETGRDVQLQ PIMKGFWESQ MVANASKTSP DESISKSVIT VGNTNVTESP TPGNLSPSHV  300
VNLMEEDFMV DELSWSGSLP SFPSPTSCMG FYGNAENITF HSLELDVPKH LNASYSASEG  360
EDLSLWLQED ILVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-51118512171NO APICAL MERISTEM PROTEIN
1ut4_B8e-51118512171NO APICAL MERISTEM PROTEIN
1ut7_A8e-51118512171NO APICAL MERISTEM PROTEIN
1ut7_B8e-51118512171NO APICAL MERISTEM PROTEIN
3swm_A9e-51118515174NAC domain-containing protein 19
3swm_B9e-51118515174NAC domain-containing protein 19
3swm_C9e-51118515174NAC domain-containing protein 19
3swm_D9e-51118515174NAC domain-containing protein 19
3swp_A9e-51118515174NAC domain-containing protein 19
3swp_B9e-51118515174NAC domain-containing protein 19
3swp_C9e-51118515174NAC domain-containing protein 19
3swp_D9e-51118515174NAC domain-containing protein 19
4dul_A8e-51118512171NAC domain-containing protein 19
4dul_B8e-51118512171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401257.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9FFI51e-61NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM0SZJ30.0M0SZJ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P18140_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-74NAC domain containing protein 71